For the best-performing peptide nasal sprays explore our popular range! We’ve got a strong line-up of the top quality best-selling peptide nasal sprays on the market. With new Nasal Sprays dropping all the time. Happy scrolling of our excellent quality nasal sprays.

Peptides Nasal Sprays

  • Aicar Nasal SprayAicar Nasal Spray Quick View
    • Sale!
      Aicar Nasal SprayAicar Nasal Spray Quick View
    • Aicar Nasal Spray

    • £23.39£41.39
    • Laboratory research studies have shown the Aicar peptide vial to have the following benefits: Increase the efficiency of energy conversion Increased capacity for adipose tissue breakdown High ability to burn fat efficiently Maintain stability during a cardiac ischemic episode Molecular Formula: C9H15N4O8P Molecular Weight: 338.21 g/mol Purity: 99% Sequence: 5-Aminoimidazole-4-carboxamide ribonucleotide 100mg in AICAR 25ml 50mg in AICAR 15ml
    • Select options
  • AOD-9604 Nasal SprayAOD-9604 Nasal Spray Quick View
    • AOD-9604 Nasal SprayAOD-9604 Nasal Spray Quick View
    • AOD-9604 Nasal Spray

    • £19.99£33.99
    • Clinical research has shown AOD-9604 to have the following potential benefits: Fat-burning properties Calorie burn is increased Fat synthesis is induced Enhances metabolic function It prevents the conversion of non-fat foods to body fat Increases your appetite but not your caloric intake Neither blood sugar levels nor tissue growth is adversely affected. May aid in bone and cartilage repair, particularly…
    • Select options
  • BPC157 and TB500 Blend Nasal SprayBPC157 and TB500 Blend Nasal Spray Quick View
  • BPC157 Nasal SprayBPC157 Nasal Spray Quick View
    • BPC157 Nasal SprayBPC157 Nasal Spray Quick View
    • BPC157 Nasal Spray

    • £17.99£27.99
    • Laboratory research has shown BPC-157 to have many benefits: Enhanced muscle strength and rate of muscle gains Effects on metabolism and weight loss Improved recovery time following injuries and workouts Memory and brain function enhancements Opioid tolerance reversal Certain allergies are alleviated GABA neurotransmission enhancement 15ml bottle contains = 2mg BPC – 157 Peptide 25ml bottle contains = 5mg BPC…
    • Select options
  • CJC-1295 DAC Nasal SprayCJC-1295 DAC Nasal Spray Quick View
    • CJC-1295 DAC Nasal SprayCJC-1295 DAC Nasal Spray Quick View
    • CJC-1295 DAC Nasal Spray

    • £29.99£53.99
    • Recent animal studies demonstrate that CJC 1295 in combination with DAC promotes the following: Enhancement of protein synthesis Increased protein consumption Bone density increase Accelerated muscle growth Increased recovery time 25ml nasal spray contains 4mg CJC1295 DAC Peptide 15ml nasal spray contains 2mg CJC1295 DAC Peptide
    • Select options
  • CJC-1295 No DAC Nasal SprayCJC-1295 No DAC Nasal Spray Quick View
    • CJC-1295 No DAC Nasal SprayCJC-1295 No DAC Nasal Spray Quick View
    • CJC-1295 No DAC Nasal Spray

    • £19.99£35.99
    • Clinical research has indicated that CJC 1295 no dac has the following benefits: Increased secretion of growth hormone and IGF-1 Improved immune function due to increased muscle growth Increased muscle mass as a result of increased protein synthesis Fat loss is enhanced Increased bone density Improved repair and regeneration of cells 15ml has 2mg CJC-1295 No DAC Peptide 25ml has…
    • Select options
  • DSIP Nasal SprayDSIP Nasal Spray Quick View
    • DSIP Nasal SprayDSIP Nasal Spray Quick View
    • DSIP Nasal Spray

    • £25.99£45.99
    • Sequence: Trp-Ala Gly Gly AspAla-Ser-Gly-Glu Molecular Formula: C35H48N10O15 Molecular Weight: 848.824 15ml containing 2mg DSIP 25ml containing 4mg DSIP
    • Select options
  • Epithalon Nasal SprayEpithalon Nasal Spray Quick View
    • Epithalon Nasal SprayEpithalon Nasal Spray Quick View
    • Epithalon Nasal Spray

    • £22.99£39.99
    • Scientific research demonstrates a variety of Epithalon benefits. In summary, the following are the health benefits of Epithalon peptide: Increases human longevity and lifespan Prevents diseases associated with ageing, such as dementia, cardiovascular disease, and cancer Promotes deeper sleep and improves the health of the skin Muscle cells are strengthened Accelerates the healing process Reduces the oxidation of lipids and…
    • Select options
  • FOXO4-DRI Nasal SpraysFOXO4-DRI Nasal Sprays Quick View
    • FOXO4-DRI Nasal SpraysFOXO4-DRI Nasal Sprays Quick View
    • FOXO4-DRI Nasal Sprays

    • £209.99£409.99
    • This Vial Contains 10mg Purity: >98% Molecular Formula: C228H388N86O64 Molecular Weight: 5358.05 g/mol Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
    • Select options
  • GHK-Cu Nasal SprayGHK-Cu Nasal Spray Quick View
  • GHRP-2 Nasal SprayGHRP-2 Nasal Spray Quick View
    • GHRP-2 Nasal SprayGHRP-2 Nasal Spray Quick View
    • GHRP-2 Nasal Spray

    • £25.99£59.99
    • Research suggests that GHRP-2 could provide the following benefits: Enhanced lean muscle mass, which aids in the growth, strength, and performance of the muscles. Overall regeneration has been improved. Assist in fat burning. It has anti-ageing and rejuvenating properties. Increased vitality and youthfulness. Assists in the production of collagen, resulting in healthier skin. It can aid in the prevention of…
    • Select options
  • GHRP-6 and CJC-1295 DAC Blend Nasal SprayGHRP-6 and CJC-1295 DAC Blend Nasal Spray Quick View
  • GHRP-6 Nasal SprayGHRP-6 Nasal Spray Quick View
    • GHRP-6 Nasal SprayGHRP-6 Nasal Spray Quick View
    • GHRP-6 Nasal Spray

    • £19.99£29.99
    • Research studies have shown GHRP-6 to have various benefits: Overall regeneration is enhanced. Effects on anti-ageing and rejuvenation. Increased vitality and radiance. Collagen production is increased, which results in healthier skin. Muscle mass and performance increase. Excess body fat loss. Restorative sleep. Capacity to mitigate the risk of heart and cardiovascular disease. Immune system fortified. 25ml nasal spray contains 10mg…
    • Select options
  • Gonadorelin Nasal SprayGonadorelin Nasal Spray Quick View
    • Gonadorelin Nasal SprayGonadorelin Nasal Spray Quick View
    • Gonadorelin Nasal Spray

    • £14.99£24.99
    • sequence: Pyr-Hls-Trp-Ser-Tyr Gly Leu Arg Pro Gly Molecular Formula: C55 H75 N17 O13 Molecular Weight: 1182.311 g/mol 25ml nasal spray contains 4mg Peptide Gonadorelin 15ml nasal spray contains 2mg Peptide Gonadorelin
    • Select options
  • Hexarelin Nasal SprayHexarelin Nasal Spray Quick View
    • Hexarelin Nasal SprayHexarelin Nasal Spray Quick View
    • Hexarelin Nasal Spray

    • £26.99£48.99
    • Sequence: H-His-D-2-Me-Trp-Ala-Trp-D-Phe-Lys-NH2 Molecular Formula: C47H58N12O6 Molecular Weight: 887.04 15ml has 5mg Hexarelin Peptide 25ml has 2mg Hexarelin Peptide
    • Select options
  • HGH Fragment 176-191 & CJC-1295 DAC Blend Nasal SprayHGH Fragment 176-191 & CJC-1295 DAC Blend Nasal Spray Quick View