Peptides Vials
-
- Vials
- Ace-031 Peptide Vial 1mg
-
£79.00
Rated 4.00 out of 5
- ACE-031 or popularly called as ACVR2B is a soluble type of the active form IIB receptor, myostatin inhibitor and other proteins which restrict the growth of the muscle.
- Add to cart
-
- Sale!
- Vials
- Aicar Peptide Vial 50mg
-
£17.99£12.99Rated 4.00 out of 5 - Molecular Formula: C9H15N4O8P Molecular Weight: 338.21 g/mol Purity: 99% Sequence: 5-Aminoimidazole-4-carboxamide ribonucleotide
- Add to cart
-
- Vials
- AMPK Peptide Vial 10mg
- £19.99
- Vial Size 10mg AMPK promotes the energy-generating processes, such as fat oxidation and glucose uptake.
- Add to cart
-
- Sale!
- AOD, Promotion, Vials
- AOD-9604 Peptide Vial
-
£11.99 – £60.99
Rated 5.00 out of 5
- Sequence: Leu-Arg-Ile-Val-Gln-Cys-Arg-Ser-Val-Glu-Gly-Ser Cys Gly Phe-Tyr Molecular Formula: C78H123N23O23S2 Molecular Weight: 1817.116
- Select options
-
- Sale!
- Blend Peptide Vials, BPC-157, Healing, Injury Recovery, TB500, Vials
- BPC157 and TB500 Blend 20mg
-
£61.99£46.99 - TB500= 10mg BPC157 Blend = 10mg
- Add to cart
-
- BPC-157, Vials
- BPC157 Peptide Vial
-
£7.99 – £32.99
Rated 4.00 out of 5
- Comes in size 2mg & 5mg Sequence: Gly- Glu-Pro-Pro-Pro-Gly-Lys-Pro-Ma Asp-Asp Ala Gly Leu Val Molecular Formula: C62H98N16O22 Molecular Weight: 1419.556
- Select options
-
- Sale!
- CJC-1295 Dac, Promotion, Vials
- CJC-1295 DAC Vial
-
£17.99 – £75.99
Rated 4.00 out of 5
- Sequence: Tyr 0 Ala Asp-Ala Ile-Phe-Thr Gln-Ser Tyr Arg-Lys Val Leu-Ala Gln Lou Ser-Ala Aro Lys Leu Leu Gln Asp-Ile-Leu-Ser-Arg Molecular Formula: C152 H252 N44 042 Molecular Weight:3357.954
- Select options
-
- Sale!
- CJC1296 NO-DAC, Promotion, Vials
- CJC-1295 No DAC Vial
-
£9.99 – £35.99
Rated 5.00 out of 5
- Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg–NH2 Molecular Formula: C152H252N44O42 Molecular Weight: 3367.97
- Select options
-
- Sale!
- Promotion, Vials
- DSIP Peptide Vial
-
£17.99 – £48.99
Rated 4.00 out of 5
- Sequence: Trp-Ala Gly Gly AspAla-Ser-Gly-Glu Molecular Formula: C35H48N10O15 Molecular Weight: 848.824 g·mol−1
- Select options
-
- EPITHALON, Vials
- Epithalon Peptide Vial
-
£15.99 – £120.00
Rated 5.00 out of 5
- Vial Comes in sizes - 10mg & 100mg Molecular Formula: C14H22N4O9 Molecular Weight: 390.349
- Select options
-
- Vials
- Follistatin 315 Peptide Vial 1mg
- £66.99
- This Vial Contains 1mg Research has suggested Follistatin is a glycoprotein, meaning that the compound contains sugars and proteins. It is naturally-occurring and produced in different forms that play distinct roles in the body.
- Add to cart
-
- Sale!
- Promotion, Vials
- Follistatin 344 Peptide Vial 1mg
-
£84.99£63.99Rated 3.00 out of 5 - Molecular Weight: 3780 g/mol
- Add to cart
-
- Vials
- FOXO4-DRI Peptide Vial 10mg
- £194.99
- This Vial Contains 10mg Purity: >98% Molecular Formula: C228H388N86O64 Molecular Weight: 5358.05 g/mol Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
- Add to cart
-
- Vials
- FTPP (Adipotide) Peptide Vial
-
£29.99 – £116.99
Rated 4.00 out of 5
- Sequence: CKGGRAKDC-GG-D(KLAKLAK)2
- Select options
-
- Sale!
- Vials
- GDF-8 Peptide Vial 1mg
-
£83.99£62.99Rated 4.00 out of 5 - 1 x GDF-8 = 1 mg Myostatin or GDF-8 has been able to improve your muscle. It also plays a vital role in the regeneration of the bone using the blocking of active myostatin which is made by a recombinant. Inhibitors of myostatin enhance the repair of wounds once you happen to have deep penetrates injuries to your muscles as…
- Add to cart
-
- Sale!
- Promotion, Vials
- GHK-Cu Peptide Vial
-
£15.99 – £60.00
Rated 4.00 out of 5
- Sequence: Gly-His-Lys Molecular Formula: C28H52CuN12O8 Molecular Weight: 748.346 g/mol Purity: >98%
- Select options
Quick Product Search
Direct Sarms Promotions {name}
1st time order discount
We offer 10% discount for all customers on first time orders.
When going through the checkout process please add the code ‘1storder’ and the 10% discount is applied.
Bulk Buy Discounts
Buy any three products and get 10% discount
FREE Delivery
Spend over £200.00 and get UK and International delivery free of charge.
Ongoing deals & Wholesale
If you are looking at purchasing a high quantity of research peptides Contact us for the best deal and look at our facebook page for daily offers and promotions.
Get 10% off your order by paying with Bitcoin securely and without fuss. Please note there is a 10 minute timelimit on the checkout.
IMPORTANT. PLEASE READ!
The products we offer are intended for IN LABORATORY USE ONLY and are NOT intended for use as food additives, drugs or household chemicals.
The products we offer ARE NOT FOR HUMAN OR ANIMAL CONSUMPTION, or to diagnose, treat or prevent any illness of disease.
By purchasing any product you acknowledge there are risks involved with their consumption.
Useful Articles
-
SNAP-8 – Botox In A BottleFebruary 15, 2021/0 Comments
-
TB500 – Benefits Of The Healing & Repairing Peptide {name}November 2, 2020/
-
SARMs Liquid vs CapsulesOctober 29, 2020/
-
-
Boost Your Immune System!October 9, 2019/
-
Melanotan 1 or Melanotan 2 – Which one?September 23, 2019/
-
Which is Safer Between MT-1 and MT-2 for Your Tanning Needs?September 20, 2019/
-
Direct Sarms Worldwide ServiceAugust 20, 2019/
-
Oxytocin Love Hormone OverviewJune 19, 2019/
-
SARMs And Weight LossJune 17, 2019/